PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pahal.A03360.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Panicinae; Panicum
Family MIKC_MADS
Protein Properties Length: 243aa    MW: 27627.3 Da    PI: 9.4756
Description MIKC_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pahal.A03360.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF89.32e-281059251
                    ---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS
          SRF-TF  2 rienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51
                    ri+n++ rqvtfskRrng+lKKA+ELS+LCdaev  iifsstg+lye+ss
  Pahal.A03360.1 10 RIDNSTSRQVTFSKRRNGLLKKAKELSILCDAEVGFIIFSSTGRLYEFSS 59
                    8***********************************************96 PP

2K-box77.73e-2677170598
           K-box   5 sgksleeakaeslqqelakLkkeienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskKnellleqieelqkkekelqeenkaLrkkl 98 
                      g+++++++   +q+e+a L+++++nLq+++++l+Ge+L+ L  ++Lq+Le++Le sl+++R +K+++l+++ieel +k  ++++en++L +++
  Pahal.A03360.1  77 LGVNNATSELMLWQREAASLRQQLHNLQESHKQLMGEELSGLGARDLQSLENRLEMSLRNVRMRKDHILKSEIEELHRKGSMIHQENMELCRRV 170
                     456678888999*****************************************************************************98876 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5006631.945161IPR002100Transcription factor, MADS-box
SMARTSM004325.8E-39160IPR002100Transcription factor, MADS-box
CDDcd002655.86E-44277No hitNo description
SuperFamilySSF554553.53E-32291IPR002100Transcription factor, MADS-box
PRINTSPR004042.1E-28323IPR002100Transcription factor, MADS-box
PfamPF003192.0E-251057IPR002100Transcription factor, MADS-box
PRINTSPR004042.1E-282338IPR002100Transcription factor, MADS-box
PRINTSPR004042.1E-283859IPR002100Transcription factor, MADS-box
PfamPF014867.3E-2685170IPR002487Transcription factor, K-box
PROSITE profilePS5129714.85586179IPR002487Transcription factor, K-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 243 aa     Download sequence    Send to blast
MGRGKIVIRR IDNSTSRQVT FSKRRNGLLK KAKELSILCD AEVGFIIFSS TGRLYEFSST  60
NMKAVIDRYG KAKEEQLGVN NATSELMLWQ REAASLRQQL HNLQESHKQL MGEELSGLGA  120
RDLQSLENRL EMSLRNVRMR KDHILKSEIE ELHRKGSMIH QENMELCRRV NIMSQQKMEL  180
HRKLQASEQR DAADANTSSS TPYSFSIAQD ADIPSNLEQI QSHQKEGENH KTGAPELGLQ  240
LH*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1tqe_P4e-20174174Myocyte-specific enhancer factor 2B
1tqe_Q4e-20174174Myocyte-specific enhancer factor 2B
1tqe_R4e-20174174Myocyte-specific enhancer factor 2B
1tqe_S4e-20174174Myocyte-specific enhancer factor 2B
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012703484.11e-163PREDICTED: MADS-box transcription factor 57-like
RefseqXP_012703481.11e-163PREDICTED: MADS-box transcription factor 57-like
SwissprotQ6Z6W21e-140MAD57_ORYSJ; MADS-box transcription factor 57
TrEMBLI1P3X21e-138I1P3X2_ORYGL; Uncharacterized protein
STRINGLOC_Os02g49840.11e-138(Oryza sativa Japonica Group)
STRINGORGLA02G0267800.11e-138(Oryza glaberrima)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP61435130
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G57230.16e-90AGAMOUS-like 16